DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and LOC100004427

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:243 Identity:75/243 - (30%)
Similarity:109/243 - (44%) Gaps:19/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHCTD--GMESVTIY 92
            |:|.:..:|..|..|.||..|:...:.| |:.|..:|.||:|...||:||..|..  .:..|.||
Zfish    28 GRAPLNTKIVGGLNATEGSWPWQASINF-KSTGQFFCSGSLISERWVLTAASCFQRINVSDVVIY 91

  Fly    93 YGALWRLQAQYTHWVGRSDFIEHGSGDISLIR-TPHVDFWSLVNKVELPRYDDRY-NNYQGWWAL 155
            .|.| .......:.:.|:......:.||:|:: :..|.|...:..|.|......: :..:.|   
Zfish    92 LGRL-TTNGSNPYEIPRTVIQVSVTEDIALVQLSSSVTFTDYIRPVCLAAAGSVFVDGTESW--- 152

  Fly   156 VSGWGKTSDEGGV-SEYLNCVDVQIGENSVCENYYGSFSGD-LIC--IPTPENKGTCSGDSGGPL 216
            |:|||.||....: |:.|..|:..|..|..|.|..|..:.| :||  ......|..|..|.|.||
Zfish   153 VTGWGSTSSTNVILSDMLKEVEAPIVNNIECSNINGITNLDNVICAGFVNETGKAPCWEDFGSPL 217

  Fly   217 VIHDGNR--QVGIVSFGSSAGCLSNG-PKGMVRVTSYLDWIRDNTGIS 261
            |...|::  |.|:|.|   ..|..|| |....||:.|.:|||:.|..|
Zfish   218 VTRQGSQWIQSGVVVF---TFCGQNGFPTLYARVSEYEEWIRNYTSSS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 68/227 (30%)
Tryp_SPc 41..257 CDD:238113 70/226 (31%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 68/227 (30%)
Tryp_SPc 36..257 CDD:238113 70/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.