DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and zgc:171592

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001104713.2 Gene:zgc:171592 / 100003031 ZFINID:ZDB-GENE-080220-23 Length:260 Species:Danio rerio


Alignment Length:290 Identity:77/290 - (26%)
Similarity:110/290 - (37%) Gaps:64/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLAVLLLGVIASATAFEKPVFWKDVPVGKASIEG-RITMGYPAYEGKVPYIVGLGFSKNGGGTWC 66
            :..:....::|||...       .||..|..|.| ||..|..|..|..|:.|.|...  .|..:|
Zfish     2 IFTITCFALVASALGC-------GVPAIKPQIIGSRIVNGQNAISGSWPWQVSLQLP--NGVHFC 57

  Fly    67 GGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWV--GRSD---------------FIE 114
            |||:|...||:||.||     ||.:.|           |.|  |..|               .:.
Zfish    58 GGSLINRNWVLTAAHC-----SVVVGY-----------HRVVLGEHDRGSNAEPIQVKLVSKVVT 106

  Fly   115 HG-------SGDISLIR--TPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSE 170
            |.       :.||:|::  :| |...:.|:.|.|.  ....|...|.....:|||:|:.... ..
Zfish   107 HPLFSRTTLNNDIALLKLASP-VTLTARVSPVCLA--PSAINIQSGTRCFTTGWGRTASTSS-PR 167

  Fly   171 YLNCVDVQIGENSVCENYYG--SFSGDLICIPTPENKGTCSGDSGGPLVIHDGN--RQVGIVSFG 231
            .|....|.:..::.|...:|  ..:..:|| .......:|.||||||||.....  ..||.||:|
Zfish   168 ILQQTSVPLVSHADCRQIWGRNRVTDAMIC-AGGSGSSSCRGDSGGPLVCERSGVWTLVGSVSWG 231

  Fly   232 SSAGCLSNGPKGMVRVTSYLDWIRDNTGIS 261
            ... |.:..|....|::....||  ||.::
Zfish   232 LDT-CNTRFPGVYARISQQRSWI--NTTVT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 65/246 (26%)
Tryp_SPc 41..257 CDD:238113 65/245 (27%)
zgc:171592NP_001104713.2 Tryp_SPc 31..256 CDD:238113 67/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.