DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and si:dkey-238d18.3

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001373176.1 Gene:si:dkey-238d18.3 / 795978 ZFINID:ZDB-GENE-131127-38 Length:272 Species:Danio rerio


Alignment Length:274 Identity:81/274 - (29%)
Similarity:119/274 - (43%) Gaps:37/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLGVLLFSAFALVAALERPV--PVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFD-----NGN 60
            ::..|.|.|..|...:.:|:  ..|:......|:|.|      :||.:..:.|||:.     ..:
Zfish     4 IISFLAFVASTLGCGVRQPLGWAAKESTTKKPIDGDI------HEGIMQGVDALRWPWQVSIKTS 62

  Fly    61 GGGWYCGGSIIGHEWVLTAAHCTYGA--SYVTISY-------GAVWRQQ--PQFTHYDTGNL--- 111
            .|...||||:|...||||||||...|  .||.:..       |.|..::  ...||.| .|:   
Zfish    63 SGEHLCGGSLINKFWVLTAAHCQIQARSHYVVLGQHDRSSNDGTVQVKEIAKVITHPD-NNIQTL 126

  Fly   112 -HNDIALIR-TPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQI 174
             :||:.|:: :......|||:.|.|.....:.  ..|...:.:|||.:..... ...|....|.|
Zfish   127 FNNDVTLLKLSSPAQMTSLVSPVCLASSSSKI--VPGTLCVTTGWGRTKTELS-ARILQEATIPI 188

  Fly   175 SDNSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGN--RQVGIVSFGSAAGCLSNS 237
            ...|.|...:|:..||::.:| |......||.|||||||:.....  .||||||:|: ..|..:.
Zfish   189 VSQSQCKQIFGASKITNSMIC-AGGSGSSSCQGDSGGPLMCESSGVWYQVGIVSWGN-RDCRVDF 251

  Fly   238 PKGLTRVTGYLDWI 251
            |....||:.:..||
Zfish   252 PLVYARVSYFRKWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 71/237 (30%)
Tryp_SPc 37..254 CDD:238113 73/238 (31%)
si:dkey-238d18.3NP_001373176.1 Tryp_SPc 52..268 CDD:238113 68/220 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.