DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and cela1.1

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:270 Identity:73/270 - (27%)
Similarity:126/270 - (46%) Gaps:29/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLGVLLFSAFALVAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCG 67
            :|.:||.|..|.: .|..|..::|:    .|..|:..|..|.....|:.::|::.:|.....|||
Zfish     1 MLRILLLSVLAAI-GLTEPRYLEDL----AIEERVIGGEIAKPHSWPWQISLQYQSGGRYHHYCG 60

  Fly    68 GSIIGHEWVLTAAHCTYGASYVTISYG---AVWRQQPQ--------FTHYD-TGNL---HNDIAL 117
            |::|...||:.||||...:...:::.|   ....:.|:        |.|.: ..|:   .|||||
Zfish    61 GTLIRPGWVMVAAHCVDTSRIWSVALGDHDTTTHEGPEQYISVKGVFIHPNWNPNIVANGNDIAL 125

  Fly   118 IR-TPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVC- 180
            :: :.:....|.|....||.|.:...  ||....::|||.:.....::..|....:.:.|:..| 
Zfish   126 LQLSINATLSSYVQVATLPSYGEILP--YGHTCYITGWGRTQTGGSLSAQLKQAYMPVVDHETCS 188

  Fly   181 -LDYYGSHYITSNHLCYATPENKGSCSGDSGGPL-VLHDGNRQV-GIVSFGSAAGCLS-NSPKGL 241
             .|::|| .:....:|.....:..:|.||||.|| .|.:|...| |:.||.:::||.: ..|...
Zfish   189 QSDWWGS-TVKDRMICAGGTTSMSACHGDSGSPLNCLFNGEYVVHGVTSFVASSGCNTYKKPTVF 252

  Fly   242 TRVTGYLDWI 251
            |||:.::.|:
Zfish   253 TRVSYHVSWL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 63/235 (27%)
Tryp_SPc 37..254 CDD:238113 63/236 (27%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 63/234 (27%)
Tryp_SPc 30..265 CDD:238113 63/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.