DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and ctrb.3

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:235 Identity:81/235 - (34%)
Similarity:114/235 - (48%) Gaps:28/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYPAYEGKVPYIVALR-FDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTI----SYGA 95
            ||.||..|.....|:.|:|: |.    |..:||||:|...||:|||||:...|:..|    :.|.
Zfish    33 RIVNGEEAVPHSWPWQVSLQDFT----GFHFCGGSLINEFWVVTAAHCSVRTSHRVILGEHNKGK 93

  Fly    96 VWRQQ--------PQFTH--YDTGNLHNDIALIR-TPHVDFWSLVNKVELPRYDDRYNNFYGWWA 149
            ...|:        ..|||  |::..:.|||||:: |......:.|:.|.|....|.:.:  |...
Zfish    94 SNTQEDIQTMKVSKVFTHPQYNSNTIENDIALVKLTAPASLNAHVSPVCLAEASDNFAS--GMTC 156

  Fly   150 LLSGWGSSSDSSGMT-DYLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPL 213
            :.||||.:..::..| |.|..|.:.:..|..|.:::||: |....:| |......||.|||||||
Zfish   157 VTSGWGVTRYNALFTPDELQQVALPLLSNEDCKNHWGSN-IRDTMIC-AGAAGASSCMGDSGGPL 219

  Fly   214 VLHDGN--RQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWI 251
            |....|  ..|||||:||:. |....|....|||...||:
Zfish   220 VCQKDNIWTLVGIVSWGSSR-CDPTMPGVYGRVTELRDWV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 80/233 (34%)
Tryp_SPc 37..254 CDD:238113 80/234 (34%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 80/233 (34%)
Tryp_SPc 34..261 CDD:238113 80/234 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.