DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and C1s1

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001091086.1 Gene:C1s1 / 50908 MGIID:1355312 Length:694 Species:Mus musculus


Alignment Length:274 Identity:76/274 - (27%)
Similarity:106/274 - (38%) Gaps:56/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LERPVPVKDMPAGN-KINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAH 81
            |.|.:|...:|... :::.||..|.||.....|:.|.......:       |::|...|||||||
Mouse   424 LPRCIPACGVPTEPFQVHQRIFGGQPAKIENFPWQVFFNHPRAS-------GALINEYWVLTAAH 481

  Fly    82 CTYGAS----YV-TISYGAVWRQQPQ-------FTH---------YDTGNLHNDIALIRTPH-VD 124
            .....|    || |:|......:..|       |.|         ....|..|||||::... |.
Mouse   482 VLEKISDPLMYVGTMSVRTTLLENAQRLYSKRVFIHPSWKKEDDPNTRTNFDNDIALVQLKDPVK 546

  Fly   125 FWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSD----------SSGMTDYLNCVDIQISDNSV 179
            ....|:.:.||.....||...|...|:|||||:..          ...:|....|..::..:.:|
Mouse   547 MGPKVSPICLPGTSSEYNVSPGDMGLISGWGSTEKKVFVINLRGAKVPVTSLETCKQVKEENPTV 611

  Fly   180 CLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQV------GIVSFGSAAGCLSNSP 238
            ..:.|   ..|.|.:| |..:...||.|||||.......|..|      |:||:|...|..    
Mouse   612 RPEDY---VFTDNMIC-AGEKGVDSCHGDSGGAFAFQVPNVTVPKFYVAGLVSWGKRCGTY---- 668

  Fly   239 KGL-TRVTGYLDWI 251
             |: |:|..|:|||
Mouse   669 -GVYTKVKNYVDWI 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 70/253 (28%)
Tryp_SPc 37..254 CDD:238113 71/254 (28%)
C1s1NP_001091086.1 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:373209
CUB 181..293 CDD:366096
CCP 307..361 CDD:153056
CCP 365..428 CDD:153056 2/3 (67%)
Tryp_SPc 443..681 CDD:214473 70/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.