DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and prss27

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:264 Identity:85/264 - (32%)
Similarity:124/264 - (46%) Gaps:56/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 INGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHC---TYGASYVTISYG 94
            ::.||..|..|.||:.|:.|:.|    |.||.:|||::|..::|::||||   :..||.||...|
 Frog    30 VSSRIMGGQSAQEGQWPWQVSFR----NNGGHFCGGTLISKQYVISAAHCFPSSSSASSVTAVLG 90

  Fly    95 AVWRQQP----------QFTHY-------DTGNLHNDIALIR--TPHVDFWSLVNKVELPRYDDR 140
            |....||          ..|:|       |:|    ||:|::  :| |.|.:.:..|.||.....
 Frog    91 AYMIDQPDGNQVAIPVQSATNYPSYVNEGDSG----DISLVQLASP-VTFTNYILPVCLPADTVT 150

  Fly   141 YNNFYGWWALLSGWGS-SSD---SSGMTDYLNCVDIQISDNSVC------LDYYGSHYIT--SNH 193
            :......|  ::|||: :||   .|.||  |..|.:.:.|.:.|      .:.||:..|:  |:.
 Frog   151 FPTGLQCW--VTGWGNIASDVSLVSPMT--LQEVAVPLIDANECNALYQTPNSYGTSSISVHSDM 211

  Fly   194 LCYA-TPENKGSCSGDSGGPLVLHDGNR--QVGIVSFGSAAGCLSNSPKGLTRVTGYLDWIRDHT 255
            :|.. ....|.||.||||||||.....:  ..|:||||...| .:..|...|.:..|.|||    
 Frog   212 ICAGFINGGKDSCQGDSGGPLVCSSSGQWFLAGVVSFGEGCG-QAYRPGVYTLMPSYTDWI---- 271

  Fly   256 GISY 259
             :||
 Frog   272 -VSY 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 81/251 (32%)
Tryp_SPc 37..254 CDD:238113 82/253 (32%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113 80/250 (32%)
Tryp_SPc 420..659 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.