DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and ctrl

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:262 Identity:85/262 - (32%)
Similarity:121/262 - (46%) Gaps:29/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFSAFALVAA-LERPVP-VKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSI 70
            :.|.|||||: |...|| :|.:.:|   ..||.||..|..|..|:.|:|:..|   |..:||||:
Zfish     4 IISCFALVASTLGCGVPAIKPVISG---YNRIVNGENAVSGSWPWQVSLQQSN---GFHFCGGSL 62

  Fly    71 IGHEWVLTAAHCTYGASYVTISYG-----------AVWRQQPQFTH--YDTGNLHNDIALIR-TP 121
            |...||:|||||...|.|..:..|           .|.......||  |::.|.:|||.|:: :.
Zfish    63 INQYWVVTAAHCRVQAGYHYVILGEHDRGSSAESVQVKSIAKAITHPYYNSQNFNNDITLLKLSS 127

  Fly   122 HVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGS 186
            .....|.::.|.|........:  |...:.:|||.:..:|. ...|....:.:...:.|..|:|.
Zfish   128 PAQLTSRISPVCLAASSTSIPS--GTRCVTTGWGKTGSTSS-PRILQQTALPLLSPAQCKQYWGQ 189

  Fly   187 HYITSNHLCYATPENKGSCSGDSGGPLVLHDGNR--QVGIVSFGSAAGCLSNSPKGLTRVTGYLD 249
            :.||...:| |......||.||||||||......  ||||||:|: :.|...:|....||:....
Zfish   190 NRITDAMIC-AGASGVSSCQGDSGGPLVCESSGAWYQVGIVSWGT-SDCNVRTPAVYARVSYLRQ 252

  Fly   250 WI 251
            ||
Zfish   253 WI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 72/230 (31%)
Tryp_SPc 37..254 CDD:238113 73/231 (32%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 72/230 (31%)
Tryp_SPc 32..257 CDD:238113 73/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.