DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CTRB2

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:238 Identity:78/238 - (32%)
Similarity:112/238 - (47%) Gaps:34/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTIS-------- 92
            ||.||..|..|..|:.|:|:   ...|..:||||:|..:||:|||||....|.|.::        
Human    33 RIVNGEDAVPGSWPWQVSLQ---DKTGFHFCGGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSD 94

  Fly    93 --------YGAVWRQQPQFTHYDTGNLHNDIALIR--TPHVDFWSLVNKVELPRYDDRYNNFYGW 147
                    ...|:: .|:|:..   .::|||.|::  || ..|...|:.|.||..||.:.  .|.
Human    95 EENIQVLKIAKVFK-NPKFSIL---TVNNDITLLKLATP-ARFSQTVSAVCLPSADDDFP--AGT 152

  Fly   148 WALLSGWGSSSDSSGMT-DYLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGG 211
            ....:|||.:..::..| |.|....:.:..|:.|...:|.. ||...:| |......||.|||||
Human   153 LCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRR-ITDVMIC-AGASGVSSCMGDSGG 215

  Fly   212 PLVLH-DGN-RQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWIR 252
            |||.. ||. ..|||||:||.. |.:.:|....||...:.|::
Human   216 PLVCQKDGAWTLVGIVSWGSRT-CSTTTPAVYARVAKLIPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 77/235 (33%)
Tryp_SPc 37..254 CDD:238113 77/237 (32%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 77/235 (33%)
Tryp_SPc 34..259 CDD:238113 77/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.