DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and Jon99Fii

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:274 Identity:160/274 - (58%)
Similarity:190/274 - (69%) Gaps:29/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLFSAFALVAAL-----ER---PVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGG 62
            :.:|.|.|:.||.     |:   |.||||:    ||.||||||||||||||||||.|.| :|| |
  Fly     3 LFVFLALAVAAATAIPTPEQKLVPTPVKDV----KIQGRITNGYPAYEGKVPYIVGLLF-SGN-G 61

  Fly    63 GWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFT------------HYDTGNLHNDI 115
            .|:|||||||:.|||||||||.|||.|||:|||..|.|||:|            ||::|||||||
  Fly    62 NWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDI 126

  Fly   116 ALIRTPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVC 180
            :||||||||||.||||||||.|:|||.::.||||:.||||.:.|.|.:.|:|..||:||...|.|
  Fly   127 SLIRTPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDC 191

  Fly   181 LDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLTRVT 245
            ...:..|   .|.:|..|...|.:|.||||||||.|:|||.||:.||.|:|||.|.:|...:|||
  Fly   192 SRSWSLH---DNMICINTNGGKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAGCQSGAPAVFSRVT 253

  Fly   246 GYLDWIRDHTGISY 259
            ||||||||:|||||
  Fly   254 GYLDWIRDNTGISY 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 137/226 (61%)
Tryp_SPc 37..254 CDD:238113 139/228 (61%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 137/226 (61%)
Tryp_SPc 38..262 CDD:238113 139/228 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470778
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.