DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and Jon99Ci

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:266 Identity:127/266 - (47%)
Similarity:165/266 - (62%) Gaps:15/266 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LGVLLFSAFALVAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGG 68
            |||.  ||..:..:|..|..::....|  |.||||||..|.||:|||||.:.. |.||..|:|||
  Fly    12 LGVC--SALTVPHSLVHPRDLEIRHGG--IEGRITNGNLASEGQVPYIVGVSL-NSNGNWWWCGG 71

  Fly    69 SIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFTHYDTG----------NLHNDIALIRTPHV 123
            |||||.|||||||||.||...::.||||...:|.|.|..:.          .|.:|:|||:||||
  Fly    72 SIIGHTWVLTAAHCTAGADEASLYYGAVNYNEPAFRHTVSSENFIRYPHYVGLDHDLALIKTPHV 136

  Fly   124 DFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGSHY 188
            ||:|||||:|||..|||||::...|...:|||:..|.|.:.:.|..||:::...:.|..|||:..
  Fly   137 DFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYGTDT 201

  Fly   189 ITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWIRD 253
            .:.|.:|..||:.|.:|.||||||||..:|::.:||.||.||.||....|.|.||||.||:||::
  Fly   202 ASENTICVETPDGKATCQGDSGGPLVTKEGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWIKE 266

  Fly   254 HTGISY 259
            .|||.|
  Fly   267 ETGIYY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 111/224 (50%)
Tryp_SPc 37..254 CDD:238113 112/226 (50%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 111/224 (50%)
Tryp_SPc 41..266 CDD:238113 112/225 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470814
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.