DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG11843

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:257 Identity:73/257 - (28%)
Similarity:110/257 - (42%) Gaps:57/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ITNGYPAYEGKVPYIVAL--RFDNGNGGGWYCGGSIIGHEWVLTAAHCTYG-------------- 85
            |..|:||...:.|::..|  |.|..:...|:|||.:|...:|||||||...              
  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELD 132

  Fly    86 ----------ASYVTISYGA-VWRQQPQFTHYDTGNLHNDIALIR-TPHVDFWSLVNKVELPRYD 138
                      ..|:...|.| ...:.|||.|        ||.|:: |..|.|....:...||..|
  Fly   133 FDSLDEDAAPRDYMVAGYIAHPGYEDPQFYH--------DIGLVKLTEAVVFDLYKHPACLPFQD 189

  Fly   139 DRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVC-------LDYYGSHYITSNHLCY 196
            :|.::.:    :..||||:..:...:..|..|.:|...|.||       ::.:...:..:|.||.
  Fly   190 ERSSDSF----IAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCV 250

  Fly   197 ATPENKGSCSGDSGGPLVLHDGNRQ-------VGIVSFGSAAGCLSNSPKGLTRVTGYLDWI 251
            .:...:.:|:|||||||:::  :|:       |||.|.|.:.|. ...|...|||..||.||
  Fly   251 GSEMAQDTCNGDSGGPLLMY--HREYPCMYVVVGITSAGLSCGS-PGIPGIYTRVYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 71/255 (28%)
Tryp_SPc 37..254 CDD:238113 73/257 (28%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 73/257 (28%)
Tryp_SPc 68..309 CDD:214473 71/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437100
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.