DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG11842

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:267 Identity:71/267 - (26%)
Similarity:106/267 - (39%) Gaps:77/267 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ITNGYPAYEGKVPYIVALRFDNGNGG-GWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQ 100
            |..|.||...:.|:...|...:.||. .|:|||::|....|||||||.|...      |:|...:
  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQ------GSVNIAR 131

  Fly   101 PQFTHYDTGN-----------------------LHNDIALIRTPH-VDFWSLVNKVELPRYDDRY 141
            .....:||.|                       ::|||:::|... |.|....:...||..|.|.
  Fly   132 LGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRL 196

  Fly   142 NNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQI---SDN----SVCLDYYGSH------------ 187
            ...:    :..|||               .::|   ::|    .|.|..||:.            
  Fly   197 GTSF----IAIGWG---------------QLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELP 242

  Fly   188 --YITSNHLCYATPENKGSCSGDSGGPLVLHDGN-----RQVGIVSFGSAAGCLSNSPKGLTRVT 245
              |..:..||..:.|:|.:|:||||||::::..:     ..:||.|.|.|.. ..:.|...|||.
  Fly   243 EGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACD-TPDLPAMYTRVH 306

  Fly   246 GYLDWIR 252
            .|||||:
  Fly   307 FYLDWIK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 69/264 (26%)
Tryp_SPc 37..254 CDD:238113 71/267 (27%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 71/267 (27%)
Tryp_SPc 73..312 CDD:214473 69/264 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.