DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG11841

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:257 Identity:66/257 - (25%)
Similarity:108/257 - (42%) Gaps:58/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ITNGYPAYEGKVPYIVALRFDNGNGG-GWYCGGSIIGHEWVLTAAHCTYG----ASYVTI----- 91
            |.:|.||...:.|:...|.....|.. .|:|||::|.:..|||||||.:.    .:.|.:     
  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEF 136

  Fly    92 ----------SYGAV-WRQQPQFTHYDTGNLHNDIALIRTPHVDFWSLVNKVELPRY-------- 137
                      .:|.: .:..|.|   :...|:|||.:::        |..:|:..||        
  Fly   137 DTDTDDAEPEDFGVLALKAHPGF---ENPQLYNDIGIVQ--------LDREVKFNRYKHPACLPF 190

  Fly   138 DD--RYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQ-ISDNSV----CLDYYGSHYITSNHLC 195
            ||  ::.:|     :..|||....:...:..|..|.:| ..|..|    ..|...:.|...:.||
  Fly   191 DDGEQHESF-----IAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPKSQLC 250

  Fly   196 YATPENKGSCSGDSGGPLVLHDGN-----RQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWIR 252
            ..:.:||.:|:||||||::.:..:     ..:||.|.|.... ..:.|...|||..:|:||:
  Fly   251 IGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCS-TPDIPSAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 64/254 (25%)
Tryp_SPc 37..254 CDD:238113 66/257 (26%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 65/255 (25%)
Tryp_SPc 72..310 CDD:214473 64/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437099
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.