DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG4815

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:244 Identity:55/244 - (22%)
Similarity:88/244 - (36%) Gaps:82/244 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AGN------KINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGAS 87
            |||      :.:.||.||   .:..|..:..:.....||....|..:::....:||||||....:
  Fly    21 AGNREEWTGRFHPRIYNG---IKTTVESLGGVGIQLFNGRKLVCSATLLTPRHILTAAHCFENLN 82

  Fly    88 YVTISYGAVWRQQPQFTHYDTGNLHN--------------------DIAL------IRTPHVDFW 126
              ...:..:..:..:||.:  ||..|                    |:|:      :|:.::.:.
  Fly    83 --RSKFHVIGGKSAEFTWH--GNNFNKNKLIRVQIHPKYAKMKFIADVAVAKTKYPLRSKYIGYA 143

  Fly   127 SLVNKVELPRYDDRYNNFYGWWALLSGWGSSS---DSS----------GMTDYLNC---VDIQIS 175
            .|...|..||  |:        .:.:|||...   |.|          |:....:|   :|.::.
  Fly   144 QLCRSVLHPR--DK--------LIAAGWGFEGGVWDESRKKTFRSMKVGIVSKRDCEKQLDRKMP 198

  Fly   176 DNSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGI 224
            .|.:|...|               .||..|.|||||||:|  |.:..||
  Fly   199 PNIICAGAY---------------NNKTLCFGDSGGPLLL--GRQVCGI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 52/231 (23%)
Tryp_SPc 37..254 CDD:238113 51/230 (22%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 47/213 (22%)
Trypsin 49..256 CDD:278516 47/213 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471127
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.