DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG16710

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:279 Identity:67/279 - (24%)
Similarity:107/279 - (38%) Gaps:71/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGW------YCGGSIIGHEWVLTAAHC--T 83
            |||     .||..|......::|::..:.:.:.:...|      .|.||:|.:.:|||||||  .
  Fly   101 MPA-----YRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRI 160

  Fly    84 YGASYVTISYGA--VWRQQPQFTHYDTGNLH---------------------------NDIALIR 119
            .|.....:..|.  :.......||.: |..|                           |||||:|
  Fly   161 TGLDLRRVRLGEHNILSNPDCVTHIN-GREHCAPEHLEIDVDLSIKHRHYMVFEERPYNDIALLR 224

  Fly   120 TPHVDFWSLVNKVELPRYDDRYNN--FYGWWALLSGWGSSSDSSGMTDYL--------NCVDIQI 174
            ......::...|....:.|..::|  |......::||| .|...|.::.|        |..:..:
  Fly   225 LKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWG-LSHKQGYSNVLLQAYVNGRNADECSL 288

  Fly   175 SDNSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPL--VLHDGNRQ----VGIVSFG-SAAG 232
            |:.|:.||       ...|:|........:|.|||||||  ::..|:.:    .||.|:| |..|
  Fly   289 SEPSLGLD-------KETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQCG 346

  Fly   233 CLSNSPKGLTRVTGYLDWI 251
               ..|...|:.:.:::||
  Fly   347 ---YGPAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 62/268 (23%)
Tryp_SPc 37..254 CDD:238113 63/269 (23%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 62/268 (23%)
Tryp_SPc 106..362 CDD:238113 61/267 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435627
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.