DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG31219

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:283 Identity:63/283 - (22%)
Similarity:110/283 - (38%) Gaps:69/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PAGNKING-----------RITNGYPAYEGKVPYIVALRFDNGNGGGW--YCGGSIIGHEWVLTA 79
            |.||::..           |:..|..|.....|::..|.:.|......  :|.||:|.:.:|||:
  Fly    69 PPGNRLPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTS 133

  Fly    80 AHCTYG----ASYVTI-----------SYGAVWRQQPQ-------------------FTHYDTGN 110
            |||..|    .|..::           :|....|.|..                   |:.....|
  Fly   134 AHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRN 198

  Fly   111 LHNDIALIRTP-HVDFWSLVNKVELPRYDDRYNNFYGWWAL----LSGWGSSSDSSGMTDYLNCV 170
            :..||||:|.. .|.:.:.:..:.:|:        :|::|.    ::|||.:::.......::..
  Fly   199 IEYDIALLRLKMPVRYRTGIMPICIPK--------HGFFAKSKLEIAGWGKTNEGQFSQVLMHGF 255

  Fly   171 DIQISDNSVCLDYYGSHYITSN---HLCYATPENKGSCSGDSGGPLVLHDGNRQV---GIVSFGS 229
               |.:.|:.:......|:..|   .:|....:...:|.|||||||::...|..|   ||.::||
  Fly   256 ---IRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITTYGS 317

  Fly   230 AAGCLSNSPKGLTRVTGYLDWIR 252
            ........|...||.:.:|.||:
  Fly   318 KNCGQIGIPGIYTRTSAFLPWIK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 58/261 (22%)
Tryp_SPc 37..254 CDD:238113 59/263 (22%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 58/261 (22%)
Tryp_SPc 90..342 CDD:238113 59/262 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435625
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.