DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG5246

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:236 Identity:77/236 - (32%)
Similarity:109/236 - (46%) Gaps:35/236 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHC-TYGASYVTISYGAVWRQ 99
            |:..|..:..|..||.|::.   ...|...||||||..:|:|||||| .:...|:.|..|.|...
  Fly    41 RVIGGVDSPTGFAPYQVSIM---NTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYT 102

  Fly   100 QPQFTH----------YDTGNLHNDIALIRTPHVDFW-------SLVNKVELPRYDDRYNNFYGW 147
            :|...:          :|....|||||||.|.....:       .|.:|..||:..|:..     
  Fly   103 RPGAEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLT----- 162

  Fly   148 WALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLD-YYGSHYITSNHLCYATPENKGSCSGDSGG 211
               |:||||:......:..|..:|:...|:..|.. ...:::::..|:|..|.|.:|||.|||||
  Fly   163 ---LTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGG 224

  Fly   212 PLVLHDGNRQ-VGIVSFGSAAGCLSNSPKGLTRVTGYLDWI 251
            |||  |.|:. ||:|::|.|  |....|.....|..|.|||
  Fly   225 PLV--DANQTLVGVVNWGEA--CAIGYPDVFGSVAYYHDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 75/234 (32%)
Tryp_SPc 37..254 CDD:238113 76/235 (32%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 75/234 (32%)
Tryp_SPc 42..263 CDD:238113 76/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436754
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.