DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG31265

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:276 Identity:86/276 - (31%)
Similarity:129/276 - (46%) Gaps:45/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLGVLLFSAFALVAALERPVP------VKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNG 59
            ||:|.:.|.    ::.|::.|.|      |...|||.  :|||..|..|..|..||.|:|:...|
  Fly     1 MKLLRLSLL----ILLAVKPPNPCESKRIVGPFPAGQ--SGRIKGGEEAEIGFAPYQVSLQPIVG 59

  Fly    60 NGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISY----------GAVWRQQPQFTH--YDTGNLH 112
            :..   |||:|:...|::||.||........::.          ||::.......|  ||...:|
  Fly    60 SHN---CGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMH 121

  Fly   113 NDIALIR-TPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSS-SDSSGMTDYLNCVDIQIS 175
            |||||:: |.::.|..|...:.||....:    .|...:|:||||. :..|.|.| |:.:.:.:.
  Fly   122 NDIALVKLTENITFNELTQPIALPTRPVQ----LGEEIVLTGWGSDVAYGSSMED-LHKLTVGLV 181

  Fly   176 DNSVCLDYYGSHYITSN----HLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSN 236
            ....|.:.:..   ||:    |:|..:.|.:|:|.||||||||  ...:.||:|::|...|.  .
  Fly   182 PLDECYETFNR---TSSMGVGHICTFSREGEGACHGDSGGPLV--SNGQLVGVVNWGRPCGV--G 239

  Fly   237 SPKGLTRVTGYLDWIR 252
            .|.....|..||||||
  Fly   240 LPDVQANVYYYLDWIR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 71/232 (31%)
Tryp_SPc 37..254 CDD:238113 73/234 (31%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 71/232 (31%)
Tryp_SPc 39..257 CDD:238113 72/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.