DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG17477

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:269 Identity:82/269 - (30%)
Similarity:114/269 - (42%) Gaps:52/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLFSA-FALVAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGS 69
            :|:||: :..:.|||.               .|..|..|.||..||.|:|:...|:   ..|||:
  Fly    10 ILVFSSLYCDLLALEH---------------FIVGGQNAAEGDAPYQVSLQTLLGS---HLCGGA 56

  Fly    70 IIGHEWVLTAAHCTYG-------ASYVTISY---GAVWRQQPQFTH--YDTGNLHNDIALIR-TP 121
            ||...|::||.||..|       .:..||.|   |||:.....:.|  ||:....|||.|:. ..
  Fly    57 IISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNE 121

  Fly   122 HVDFWSLVNKVEL-----PRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVC- 180
            .:.|.:|...|||     ||....        .:.:||||.|.:..:...|..|..|..::..| 
  Fly   122 SITFNALTQAVELPTSPFPRGASE--------LVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACE 178

  Fly   181 --LDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLTR 243
              :..|....:...|:|.....|.|:|.|||||||| |.|. .|||::|  ...|....|.....
  Fly   179 SMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLV-HQGT-LVGILNF--FVPCAQGVPDIFMN 239

  Fly   244 VTGYLDWIR 252
            :..|.||:|
  Fly   240 IMYYRDWMR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 74/235 (31%)
Tryp_SPc 37..254 CDD:238113 76/237 (32%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 76/237 (32%)
Tryp_SPc 27..246 CDD:214473 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.