DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and modSP

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:284 Identity:67/284 - (23%)
Similarity:95/284 - (33%) Gaps:86/284 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PVKDMPAGNKINGRITNGYPAYEGKVPYIVALR-FDNGNGGGWYCGGSIIGHEWVLTAAHCTYGA 86
            |:|...:|         ||......||:.|.|. :.|.....:.||||::..:.|:|||||.|..
  Fly   364 PIKQFSSG---------GYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDE 419

  Fly    87 ------SYVTI---------SYGAVWRQQPQFTHYD-------------TGNLHNDIAL------ 117
                  ||.|.         :||   ...|:....|             |.|.:.|:||      
  Fly   420 GTRLPYSYDTFRVIAAKFYRNYG---ETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEP 481

  Fly   118 ------IRTPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISD 176
                  ||...|.|.|...|..:.  ||....|.||         :.::.....::..|.   ..
  Fly   482 FELSHVIRPICVTFASFAEKESVT--DDVQGKFAGW---------NIENKHELQFVPAVS---KS 532

  Fly   177 NSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAA-----GCLSN 236
            ||||  ......|.::..|..|.....:|.|||||...   ........|..:.|     |.:||
  Fly   533 NSVC--RRNLRDIQADKFCIFTQGKSLACQGDSGGGFT---SELPTNAFSTWNTARHFLFGVISN 592

  Fly   237 SPKG---------LTRVTGYLDWI 251
            :|..         :|.:..:.|.|
  Fly   593 APNADQCAHSLTVMTNIQHFEDMI 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 63/269 (23%)
Tryp_SPc 37..254 CDD:238113 64/270 (24%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 64/275 (23%)
Tryp_SPc 371..591 CDD:304450 59/250 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436752
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.