DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and snk

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:271 Identity:72/271 - (26%)
Similarity:107/271 - (39%) Gaps:63/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GNKINGR--------ITNGYPAYEGKVPYIVALRFDNGNGG-----GWYCGGSIIGHEWVLTAAH 81
            |...:|:        |..|.|...|..|::.||.:..|:|.     .|.|||:::...:||||||
  Fly   171 GRTFSGKQCVPSVPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAH 235

  Fly    82 CTYGASYV--TISYGAVWRQQPQFTH-------------YDTGNLHNDIALIR-TPHVDF----- 125
            |....|..  .:..||....:...|.             |.:...::||||:: |..|.|     
  Fly   236 CATSGSKPPDMVRLGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVR 300

  Fly   126 ----WSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGS 186
                |.| .::::|.            .:.:|||.:......::.|..||:.:.....|...|..
  Fly   301 PACLWQL-PELQIPT------------VVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRK 352

  Fly   187 HY-----ITSNHLCYA-TPENKGSCSGDSGGPL--VLHDGN---RQVGIVSFGSAAGCLSNSPKG 240
            ..     |.....|.. .|..:.:|.||||||:  :|.:.|   ..|||.|||..... .|:|..
  Fly   353 ERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAA-PNAPGV 416

  Fly   241 LTRVTGYLDWI 251
            .||:..|||||
  Fly   417 YTRLYSYLDWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 68/263 (26%)
Tryp_SPc 37..254 CDD:238113 70/256 (27%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 70/256 (27%)
Tryp_SPc 186..427 CDD:214473 68/254 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436960
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.