DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and MP1

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:275 Identity:79/275 - (28%)
Similarity:118/275 - (42%) Gaps:58/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GNKINGRITNGYPAYEGKVPYIVALRFDN-GNGGGWYCGGSIIGHEWVLTAAH------------ 81
            |.....|:..|....:.:.|::..:.:.. ||..|.:||||:|.|.:||||||            
  Fly   131 GENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELT 195

  Fly    82 --------------CTYGAS--------YVTISYGAVWR-QQPQFTHYDTGNLHNDIALIR-TPH 122
                          ||.|.:        ||  .|....| ..||:.......| |||||:| ...
  Fly   196 GVRLGEWDASTNPDCTVGKNGRRDCNEPYV--DYPVEERIPHPQYPGNSRDQL-NDIALLRLRDE 257

  Fly   123 VDFWSLVNKVELPRYDDRYNN-FYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSV----CLD 182
            |.:...:..|.||....::|| |.|...:::|||.:.     |::.:.:.::...::|    |..
  Fly   258 VQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTE-----TNFTSNIKLKAELDTVPTSECNQ 317

  Fly   183 YYGS--HYITSNHLCYATPENKGSCSGDSGGPLVLHD---GNRQ---VGIVSFGSAAGCLSNSPK 239
            .|.:  ..:|:..:|....|...||.|||||||:|.|   ||..   .|:||:|.....|...|.
  Fly   318 RYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPG 382

  Fly   240 GLTRVTGYLDWIRDH 254
            ..|||..||:||.::
  Fly   383 VYTRVEAYLNWIENN 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 76/264 (29%)
Tryp_SPc 37..254 CDD:238113 77/266 (29%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 76/264 (29%)
Tryp_SPc 138..397 CDD:238113 77/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435632
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.