DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and ela2

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001132936.1 Gene:ela2 / 403061 ZFINID:ZDB-GENE-041117-1 Length:266 Species:Danio rerio


Alignment Length:274 Identity:86/274 - (31%)
Similarity:124/274 - (45%) Gaps:38/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLGVLLFSAFALVAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWY 65
            ||::.:.||.|.|....         .|....|:.|:..|........|:..:|::.:|:.....
Zfish     1 MKLVILALFIAGAYGCG---------QPTYKPIDSRVVGGSDVRPNSWPWQASLQYQSGSSFYHT 56

  Fly    66 CGGSIIGHEWVLTAAHCTYGASYVTI---------SYGAVWRQQPQ----FTHYDTGNLHNDIAL 117
            |||::|..:||||||||....:|..:         |........|.    ..::|:.|:.|||||
Zfish    57 CGGTLIDKQWVLTAAHCISSRTYRVLLGKHNLPLSSESGSQAISPARIIVHENWDSYNIRNDIAL 121

  Fly   118 IR--TPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVC 180
            |:  || |.|...::...||  |......:.....::|||.......:.|.|....:.|.|.:.|
Zfish   122 IKLSTP-VTFTDKISPACLP--DSGSILPHNSPCYVTGWGRLWTGGPIADILQQALLPIVDQATC 183

  Fly   181 L--DYYGSHYITSNHLCYATPENKGSCSGDSGGPL--VLHDGNRQV-GIVSFGSAAGCLSNSPKG 240
            .  |::| :.:|...:|........||:|||||||  ...||...| |||||||:.||  |.||.
Zfish   184 TKSDWWG-NLVTDLMVCAGGDGVVSSCNGDSGGPLNCQRRDGTWDVHGIVSFGSSLGC--NYPKK 245

  Fly   241 ---LTRVTGYLDWI 251
               .|||:||:.||
Zfish   246 PSVFTRVSGYIPWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 76/237 (32%)
Tryp_SPc 37..254 CDD:238113 77/238 (32%)
ela2NP_001132936.1 Tryp_SPc 27..259 CDD:214473 76/237 (32%)
Tryp_SPc 28..262 CDD:238113 77/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.