DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG14088

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:224 Identity:49/224 - (21%)
Similarity:74/224 - (33%) Gaps:67/224 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GSIIGHEWVLTAAHCTYGASYVTI-----SYG------------AVWRQQPQFTHYDTGNLHNDI 115
            |::|...::||..||  |.|...|     .||            |.:.....|......|....:
  Fly    60 GTLIHERFILTDVHC--GDSIGVIRARLGEYGRIGSELAEDHIVAAFFSNANFNPETQANNMGLM 122

  Fly   116 ALIRT----PHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISD 176
            .|:||    .|:....::....:..:.|..:.|.|     :.| .:||.|.|......:.:.   
  Fly   123 KLLRTVVYKEHIIPVCILMDSRMQTFADELDYFNG-----TTW-KNSDKSPMLRSKTVIRMP--- 178

  Fly   177 NSVC--LDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVS------FGSA--- 230
             ..|  ||:        ...| |..::..||...||..|     .|::..:.      ||.|   
  Fly   179 -QACGKLDH--------GQFC-AGHKDLDSCDEPSGAAL-----TREIDYIGPNRTVLFGIANSV 228

  Fly   231 -AGCLSNSPKGLTRVTGYLDWIRDHTGIS 258
             ..| |||       ..|.|.::.|..||
  Fly   229 EVKC-SNS-------RTYTDVVQLHQWIS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 46/215 (21%)
Tryp_SPc 37..254 CDD:238113 46/218 (21%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 49/224 (22%)
Tryp_SPc 42..248 CDD:214473 47/221 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.