DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG18223

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:299 Identity:71/299 - (23%)
Similarity:119/299 - (39%) Gaps:78/299 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KVLGVLLFSAFALVAALERPVPVKDMPAGNKING--------RITNGYPAYEGKV---PYIVALR 55
            |:...|||....|        |:.|  ||:.|..        |:::.|...|..:   .|:|::|
  Fly    11 KIFSFLLFLLLLL--------PILD--AGDPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIR 65

  Fly    56 FDNGN---GGGWYCGGSIIGHEWVLTAAHC-------TYGASYVTISYGAVWRQQ---------- 100
            ....:   |...:|||.||...::||:|||       .:.:..:.:..|...|.:          
  Fly    66 SRRPHKLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNME 130

  Fly   101 -------PQFTHYDTGNLHNDIALI----RTPHVDFWSLVNKVELPRYDDRYNNFY---GWWALL 151
                   .:||.::|    |:|||:    :.|..:  .||..:.||..|......|   ||..:.
  Fly   131 VKKIFVPDKFTVFNT----NNIALMMLAKKLPLDN--PLVGVINLPTADPEPGLNYTVLGWGRIF 189

  Fly   152 SGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPEN---KGSCSGDSGGPL 213
            .|...:||       :..:|:::....:|....  |......:|.....|   :..|:||:|.||
  Fly   190 KGGPLASD-------ILHIDVELLPRDICEKKV--HIFKEEMMCAGNLNNTMDENPCAGDTGSPL 245

  Fly   214 VLHDGNRQVGIVSFGSAAGCLSNS-PKGLTRVTGYLDWI 251
            :.::  ...|:||:  ..||.|.: |...|.|..::|||
  Fly   246 IFNE--TVFGVVSY--RVGCGSKTLPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 59/255 (23%)
Tryp_SPc 37..254 CDD:238113 60/256 (23%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 58/240 (24%)
Tryp_SPc 60..280 CDD:214473 56/238 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436753
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.