DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG7542

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:249 Identity:89/249 - (35%)
Similarity:128/249 - (51%) Gaps:23/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTI 91
            :|....:...||||.||..|:.||...|....||...| |||::|.|.|::|||||..||..||:
  Fly    17 VPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTW-CGGTLISHYWIITAAHCMDGAESVTV 80

  Fly    92 SYGAV----WRQQPQ------------FTHYDTGNLHNDIALIRTP-HVDFWSLVNKVELP-RYD 138
            ..||:    ..::.|            .::|....:.|||:|||.| .|.|...:....|| |.:
  Fly    81 YLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLN 145

  Fly   139 DRYNNFYGWWALLSGWGSSSDSS-GMTDYLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPENK 202
            .::..:....|..||||..||:| .::..|..|::.|..:|:|..|: |..::...:|.:|...|
  Fly   146 GQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYW-SGAVSEKMICMSTTSGK 209

  Fly   203 GSCSGDSGGPLVLHDGNRQ--VGIVSFGSAAGCLSNSPKGLTRVTGYLDWIRDH 254
            .:|.||||||||...||..  :|..|||::.||....|...||::.|||||.:|
  Fly   210 STCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWILNH 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 85/235 (36%)
Tryp_SPc 37..254 CDD:238113 87/237 (37%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 87/237 (37%)
Tryp_SPc 27..260 CDD:214473 85/234 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470924
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.