DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG18180

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:282 Identity:123/282 - (43%)
Similarity:156/282 - (55%) Gaps:41/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLGVLLFSAFALVAALERPVPVKDMPAG-NK-------INGRITNGYPAYEGKVPYIVAL--R 55
            ||:..:.|.:|.|||||         .|.| |:       ..|||.|||||.|||.||||.|  |
  Fly     1 MKLFLLTLSAALALVAA---------SPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIR 56

  Fly    56 FDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVW----------RQQPQFTHYD--- 107
            .|..|.|. ...|:||.::|:||||||..| .||.|.||:.|          |:....:|.|   
  Fly    57 TDGSNSGA-VGAGTIIANDWILTAAHCLTG-DYVEIHYGSNWGWNGAYRQTVRRDNFISHPDWPS 119

  Fly   108 TGNLHNDIALIRTPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDI 172
            .|.  .||.|||||||||..|:||:.||..:::.:.:...|.:..||| ..|:..:.|:|.|||:
  Fly   120 QGG--RDIGLIRTPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWG-GMDNGNLADWLQCVDV 181

  Fly   173 QISDNSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNS 237
            ||..||.|...|||  :.|..:|....:.|..|.||||||||.||..|.||:::|.|.: | .:.
  Fly   182 QIISNSECEQAYGS--VASTDMCTRHADGKSVCGGDSGGPLVTHDNARLVGVITFASVS-C-HDG 242

  Fly   238 PKGLTRVTGYLDWIRDHTGISY 259
            |.|.|||:.||:||||.|||||
  Fly   243 PSGYTRVSDYLEWIRDQTGISY 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 101/229 (44%)
Tryp_SPc 37..254 CDD:238113 103/231 (45%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 101/229 (44%)
Tryp_SPc 36..259 CDD:238113 103/231 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470758
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.