DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG18179

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:275 Identity:119/275 - (43%)
Similarity:146/275 - (53%) Gaps:23/275 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLGVLLFSAFALVAA---LERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVAL--RFDNGN 60
            ||:..:.|..|.|:|||   ..|...:..:.......|||.|||||.|||.||||.|  |.|..|
  Fly     1 MKLFLLTLSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSN 65

  Fly    61 GGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQF---THYDTGNLH--------ND 114
            ... ...|:||..:|:|||||| ....||.|.||:.|.....|   ...|....|        .|
  Fly    66 SAA-VGAGTIIASDWILTAAHC-LTTDYVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPAEGGRD 128

  Fly   115 IALIRTPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSV 179
            |.|||||.|.|..|:|||.||.:.:..:.|...|.:..||| ..|:..:.|:|.|:|:||..||.
  Fly   129 IGLIRTPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWG-GMDNGNLADWLQCMDVQIISNSE 192

  Fly   180 CLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLTRV 244
            |...||:  :.|..:|....:.|.||.||||||||.||..|.||:::||| ..|.| .|.|.|||
  Fly   193 CEQSYGT--VASTDMCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITFGS-VDCHS-GPSGYTRV 253

  Fly   245 TGYLDWIRDHTGISY 259
            |.||.||||:|||||
  Fly   254 TDYLGWIRDNTGISY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 100/227 (44%)
Tryp_SPc 37..254 CDD:238113 102/229 (45%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 100/227 (44%)
Tryp_SPc 40..263 CDD:238113 102/229 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470770
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.