DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG3088

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:265 Identity:112/265 - (42%)
Similarity:152/265 - (57%) Gaps:19/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLGVLLFSAFALVAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWY 65
            ||:|  ::|....||||....   ||....:.|   ||||.|||||:.||:|.:.|...|   .:
  Fly     1 MKLL--VVFLGLTLVAAGSAK---KDSEDPDHI---ITNGSPAYEGQAPYVVGMAFGQSN---IW 54

  Fly    66 CGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFT------HYDTGNLHNDIALIRTPHVD 124
            |.|:|||..|:||:|.|..|:|.|||.:||....|.|||      .|.|||.|  :||:|.|.|.
  Fly    55 CSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEYVTGNQH--LALVRVPRVG 117

  Fly   125 FWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGSHYI 189
            |.:.||:|.||...:|...:..|||.:.|||.::.|:|:||.|.|||:||..|:.|:.:|||..:
  Fly   118 FSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTV 182

  Fly   190 TSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWIRDH 254
            :...||..||..:.:|.||:|.||:....:..|||.:|.::.||....|.|..|:|..||||...
  Fly   183 SDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFARITSALDWIHQR 247

  Fly   255 TGISY 259
            |||:|
  Fly   248 TGIAY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 95/220 (43%)
Tryp_SPc 37..254 CDD:238113 97/222 (44%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 97/221 (44%)
Tryp_SPc 29..244 CDD:214473 95/219 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470799
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.