DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and Jon66Cii

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:273 Identity:150/273 - (54%)
Similarity:176/273 - (64%) Gaps:26/273 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLGVLLFSAFALVA-------ALER--PVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRF 56
            ||....:|..|.|..:       |.|:  ||..|||      .|||||||||.|||.||.|.|.|
  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHTKDM------QGRITNGYPAEEGKAPYTVGLGF 59

  Fly    57 DNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFTHY-DTGNL--HN--DIA 116
                .|||:||||||.|:|||||.||...|..||:.:||.||...||||: ..||.  |:  |||
  Fly    60 ----SGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHSSADIA 120

  Fly   117 LIRTPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCL 181
            |||.||||||.:|||||||.|:||||::..|||:..|||.:.|.|.:.|||.|||:||..||.|.
  Fly   121 LIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECS 185

  Fly   182 DYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLTRVTG 246
            .||||  :..|.||..||:.|.:|.||||||||.|||.:.||:.:|||.|||.|.:|.|..|||.
  Fly   186 GYYGS--VGDNILCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTY 248

  Fly   247 YLDWIRDHTGISY 259
            :||||||||||:|
  Fly   249 HLDWIRDHTGIAY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 128/219 (58%)
Tryp_SPc 37..254 CDD:238113 130/221 (59%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 128/219 (58%)
Tryp_SPc 40..256 CDD:238113 130/221 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470782
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.