DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG33460

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:239 Identity:56/239 - (23%)
Similarity:89/239 - (37%) Gaps:65/239 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWR-----QQPQFTHY-- 106
            |:...|..|    |..:|.|::|...::||||.| ...:.|.:..|...|     .:....||  
  Fly    44 PWTALLHTD----GSIFCAGTLITDVFILTAASC-IRPNAVKVRLGEFGRYPNELPEDHLVHYFL 103

  Fly   107 -----DTGNLHNDIALIRTPHVDFWSLVNKVELPRY-----------DDRYN--NFYGWWALLSG 153
                 :..:|.|:|.|::        |..:|::..|           :.:.:  .|.|     :.
  Fly   104 MYRLFNNESLANNIGLLK--------LTKRVQITDYIMPVCIVLNPQNQQLSTMRFIG-----NA 155

  Fly   154 WGSSSDSSGMTDYLNCVDIQISDNSVC--LDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLH 216
            |...|:.| :|..|..:.|| |...:|  ||.|       ...|.....|..||.|.:|..|:  
  Fly   156 WMEDSNVS-LTKELRPIVIQ-SKPKMCTNLDLY-------TQFCAGHQGNLRSCDGLTGSALI-- 209

  Fly   217 DGNRQVG---IVSFGSAA----GCLSNSPKGLTRVTGYLDWIRD 253
            ..:|.:.   .:.||.|.    .|  ...:|.|.|..:..||:|
  Fly   210 QNSRYMNKYRHIQFGIATVNDMDC--EESQGYTDVLKFYWWIQD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 53/235 (23%)
Tryp_SPc 37..254 CDD:238113 56/239 (23%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 56/239 (23%)
Tryp_SPc 44..249 CDD:214473 53/235 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435641
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.