DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG10469

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:289 Identity:86/289 - (29%)
Similarity:122/289 - (42%) Gaps:61/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLGVLLFSAFALVAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVAL--RFDNGNGGGWY 65
            :|.::|...|:||...|         .|:.   ||.||..|...::||.|.|  .|:........
  Fly     2 ILQLVLIVQFSLVFGQE---------TGSL---RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNM 54

  Fly    66 CGGSIIGHEWVLTAAHCTYGAS---------------------YVTISYGAVWRQQPQFTHYDTG 109
            |||:|:.:.|::|||||.....                     .|..||..|.::      :|..
  Fly    55 CGGTILSNRWIITAAHCLQDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKK------FDRK 113

  Fly   110 NLHNDIALIRTP-HVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDS--SGMTDYLNCVD 171
            .:.||||||:.| .:.|...:...:||.....|.   |..|::||||.::..  |.:..|:..  
  Fly   114 TVTNDIALIKLPKKLTFNKYIQPAKLPSAKKTYT---GRKAIISGWGLTTKQLPSQVLQYIRA-- 173

  Fly   172 IQISDNSVC-------LDYYGSHYITSNHLCYATPENKG-SCSGDSGGPLVLHDGNRQ-VGIVSF 227
             .|..|..|       |.......:.:..:|  ....|| .|.||||||:||.||:|. |||||.
  Fly   174 -PIISNKECERQWNKQLGGKSKKVVHNGFIC--IDSKKGLPCRGDSGGPMVLDDGSRTLVGIVSH 235

  Fly   228 GSAAGCLSNSPKGLTRVTGYLDWIRDHTG 256
            |....|....|...|||:.||.||:.::|
  Fly   236 GFDGECKLKLPDVSTRVSSYLKWIKYYSG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 76/249 (31%)
Tryp_SPc 37..254 CDD:238113 77/251 (31%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 76/249 (31%)
Tryp_SPc 24..260 CDD:238113 76/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470975
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.