DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG10472

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:263 Identity:96/263 - (36%)
Similarity:135/263 - (51%) Gaps:30/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LERPVPV---KDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTA 79
            :|.|:|.   :.:|     :||||.|..|...:.||.|.|......|..| |||:||...|::||
  Fly    30 IETPMPKVHGETLP-----SGRITGGQIAEPNQFPYQVGLLLYITGGAAW-CGGTIISDRWIITA 88

  Fly    80 AHCTYG-ASYVTISYGAVWR-----QQPQFTHYDTGN-----------LHNDIALIRTP-HVDFW 126
            ||||.. .:.|.:..||..|     :..|....:|.|           :.|||:||:.| .::|.
  Fly    89 AHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFN 153

  Fly   127 SLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDS-SGMTDYLNCVDIQISDNSVCLDYYGSHYIT 190
            ..:...:||...|.|:.:.|..|:.||||..||| :|.||.|....:.|.:||.|..:|.. .:.
  Fly   154 KYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFG-LVA 217

  Fly   191 SNHLCYATPENKGSCSGDSGGPLVLHDG-NRQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWIRDH 254
            ::::|..|.....:|:|||||||||.|| |..:|..|||.|.||....|...||:|.|||||.:.
  Fly   218 ASNICIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDWIEEK 282

  Fly   255 TGI 257
            :|:
  Fly   283 SGV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 88/234 (38%)
Tryp_SPc 37..254 CDD:238113 89/236 (38%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 88/234 (38%)
Tryp_SPc 47..282 CDD:238113 89/236 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470902
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.