DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG6592

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:273 Identity:96/273 - (35%)
Similarity:127/273 - (46%) Gaps:35/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LVAALE-RPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVL 77
            ||..|| .|:..|.:|.|.....||..|........||.|.:......|..| ||||:|..:.|:
  Fly    99 LVLNLETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYW-CGGSLISDKHVI 162

  Fly    78 TAAHCTYGASYVTISYGA-------------VWRQQPQFTHYDTGN---LHNDIALIRTPH-VDF 125
            |||||...|....:..||             :......|..|.|.|   |.:|||::|.|| |.|
  Fly   163 TAAHCVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSF 227

  Fly   126 WSLVNKVELPRYDDRYNNFYGWWALLSGWGS-SSDSSGMTDYLNCVDIQISDNSVC-----LDYY 184
            ...::.::||:....|.:|....|:.||||. ::....:::.|..|.:||.|...|     |.|.
  Fly   228 NERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYR 292

  Fly   185 GSHYITSNHLCYATPENKGSCSGDSGGPLVL---HDGNR-QVGIVSFGSAAGCLSNSPKGLTRVT 245
            |::..||..      ..:.:|:|||||||||   |...| .|||.||||..||....|...|:|.
  Fly   293 GTNICTSGR------NARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVA 351

  Fly   246 GYLDWIRDHTGIS 258
            .|||||.|.||:|
  Fly   352 SYLDWISDETGVS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 82/241 (34%)
Tryp_SPc 37..254 CDD:238113 83/243 (34%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 82/241 (34%)
Tryp_SPc 123..359 CDD:238113 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470976
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.