DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and Jon65Ai

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:267 Identity:180/267 - (67%)
Similarity:208/267 - (77%) Gaps:13/267 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLGVLLFSAFALVAALERPVPVKDMPAGN-KINGRITNGYPAYEGKVPYIVALRFDNGNGGGW 64
            ||||.|||....|...|.|:||..||:|.|. .|.||||.|||||||||||||.|.|.. ||||.
  Fly     1 MKVLAVLLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSK-NGGGT 64

  Fly    65 YCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFTHY-------DTGNLHNDIALIRTPH 122
            :|||||||:.||:||.|||.|...|||.|||:||.|.|:||:       :.|:  .||:||||||
  Fly    65 WCGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDFIEHGS--GDISLIRTPH 127

  Fly   123 VDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGSH 187
            |||||||||||||||||||||:.|||||:||||.:||..|:::||||||:||.:||||.:|||| 
  Fly   128 VDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVCENYYGS- 191

  Fly   188 YITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWIR 252
             .:.:.:|..||||||:||||||||||:||||||||||||||:||||||.|||:.|||.||||||
  Fly   192 -FSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNGPKGMVRVTSYLDWIR 255

  Fly   253 DHTGISY 259
            |:|||||
  Fly   256 DNTGISY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 153/221 (69%)
Tryp_SPc 37..254 CDD:238113 155/223 (70%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 153/221 (69%)
Tryp_SPc 41..257 CDD:238113 153/220 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470688
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.