DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:280 Identity:131/280 - (46%)
Similarity:168/280 - (60%) Gaps:27/280 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLGVLLFSAFALVAA----LERPVPV--KDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNG 59
            ||||.|.   |.||..|    |.:.||:  :|:||...|.||||||..|..|:.||.|.|.|.: 
  Fly     1 MKVLVVF---ALALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFAS- 61

  Fly    60 NGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFTH------------YDTGNLH 112
            ..|.|:||||||.:.|||||||||.|||.|||.|||..|...|...            |::..|.
  Fly    62 TSGSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTSAQLVQTVSADNFVQHASYNSIVLR 126

  Fly   113 NDIALIRTPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISD- 176
            |||:||:||.|.|.:|:||||||.....|:.:.|..|:.||||.:|||:  |...|.:..::.: 
  Fly   127 NDISLIKTPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSA--TSVANTLQYEVFEV 189

  Fly   177 --NSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPK 239
              .|.|.:.|||...|:|.:|.|||....:|:|||||||||...::.:|:.||.|:|||.|.:|.
  Fly   190 VSVSQCQNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDSKLIGVTSFVSSAGCESGAPA 254

  Fly   240 GLTRVTGYLDWIRDHTGISY 259
            |.||||.|||||:.:||:||
  Fly   255 GFTRVTSYLDWIKTNTGVSY 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 108/229 (47%)
Tryp_SPc 37..254 CDD:238113 109/231 (47%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 108/229 (47%)
Tryp_SPc 40..269 CDD:238113 109/231 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470844
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.