DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and yip7

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:273 Identity:122/273 - (44%)
Similarity:159/273 - (58%) Gaps:19/273 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLGVLLFSAFALVAAL---ERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGG 62
            |||..||:.:..:..|.|   ..||..:|..:...|.||||||..|..|:.||.|.|.| :.:.|
  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSF-SSSAG 64

  Fly    63 GWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFTH------------YDTGNLHNDI 115
            .|:|||||||:||||||||||.||:.|||.|||..|..|:||.            |....:.|||
  Fly    65 SWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDI 129

  Fly   116 ALIRTPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSD-SSGMTDYLNCVDIQISDNSV 179
            :||:|..|.|.:.|||:.||...:.|:.:.|..|:.||||.:|| ::.::..|..||:.|..||.
  Fly   130 SLIQTSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSK 194

  Fly   180 CLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLTRV 244
            |.:.:||..:||..||..|.....:|.|||||||.| || ..:|..|||||.||.|.:|...||:
  Fly   195 CQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLAL-DG-VLIGATSFGSADGCESGAPAAFTRI 257

  Fly   245 TGYLDWIRDHTGI 257
            |.|.|||::.:||
  Fly   258 TYYRDWIKETSGI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 106/227 (47%)
Tryp_SPc 37..254 CDD:238113 107/229 (47%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 106/227 (47%)
Tryp_SPc 40..267 CDD:238113 107/229 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470842
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.