DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG30283

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:279 Identity:78/279 - (27%)
Similarity:121/279 - (43%) Gaps:58/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLFSAFALV-------AALERP---VPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGN 60
            |:|.:|.::|       :.||.|   ||:...        :|..|:.|.....|::..:..:   
  Fly    10 VVLLAASSVVVLGSESGSFLEHPCGTVPISQF--------KILGGHNAPVASAPWMAMVMGE--- 63

  Fly    61 GGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQ--------QPQFTHYDTGNLHNDIAL 117
             ||::|||::|.:.:|||:|||..... :.:..|.:.|:        ...|.|.|.....:|:||
  Fly    64 -GGFHCGGTLITNRFVLTSAHCIANGE-LKVRLGVLEREAEAQKFAVDAMFVHTDYYFDQHDLAL 126

  Fly   118 IR-TPHVDFWSLVNKVEL------PRYDDRYNNF--YGWWALLSGWGSSSDSSGMTDYLNCVDIQ 173
            :| ...|.:...::.:.|      ...|:....|  |||     |...|..||.|....:..::.
  Fly   127 LRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGW-----GKTESRSSSRMLQKTSLFNLH 186

  Fly   174 ISDNSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPL---VLHDGNR---QVGIVSFGSAAG 232
            .|:   |...|....|..||:| |...|..:|:|||||||   |.:|..:   |.|:.|||. |.
  Fly   187 RSE---CAKQYPHQQINRNHIC-AESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGH-AD 246

  Fly   233 CLSNSPKGLTRVTGYLDWI 251
            |  :.....|.|..:||||
  Fly   247 C--SKATVFTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 67/237 (28%)
Tryp_SPc 37..254 CDD:238113 69/238 (29%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 67/237 (28%)
Tryp_SPc 43..266 CDD:238113 69/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.