DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and Prss48

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:290 Identity:84/290 - (28%)
Similarity:124/290 - (42%) Gaps:63/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLGVLLFSAFA--------LVAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFD 57
            :|||.:|...||.        |.:...|||.          .|||..|..|..|:.|:.|:||||
Mouse     6 LKVLLLLFLGAFQGSFTKKKNLQSVCGRPVH----------TGRIVGGQDAALGRWPWQVSLRFD 60

  Fly    58 NGNGGGWYCGGSIIGHEWVLTAAHC---TYGASYVTISYGAVWRQQPQFTHYDTG---------- 109
            ..:.    ||||:|...||||||||   |:.:...::..|::.|:     :..||          
Mouse    61 YTHS----CGGSLISDHWVLTAAHCIKKTWYSFLYSVWLGSIDRE-----YSSTGKEYYVSRIAI 116

  Fly   110 -----NLHNDIALIR-TPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLN 168
                 :...||||:: :..|.|.|::..:.||....:.......|  ::|||.:.:.. ....|.
Mouse   117 PDKHRHTEADIALLKLSSRVTFSSVILPICLPNISKQLTVPASCW--VTGWGQNQEGH-YPSTLQ 178

  Fly   169 CVDIQISDNSVCLDYYG---------SHYITSNHLCYATPEN-KGSCSGDSGGPLVLH-DGN-RQ 221
            .:::.:..:..|...|.         ...|..:..|....:: |.||.|||||||..| ||. |.
Mouse   179 ELEVPVISSEACEQLYNPIGVFLPDLERVIKEDMFCAGERQSRKDSCKGDSGGPLSCHIDGVWRL 243

  Fly   222 VGIVSFGSAAGCLSNSPKGLTRVTGYLDWI 251
            :|:||:|...|  .:.|...|.||.|..||
Mouse   244 MGVVSWGLECG--KDLPGVYTNVTYYQKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 71/245 (29%)
Tryp_SPc 37..254 CDD:238113 72/246 (29%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 71/245 (29%)
Tryp_SPc 40..274 CDD:238113 72/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.