DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and Ctrc

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:277 Identity:78/277 - (28%)
Similarity:125/277 - (45%) Gaps:39/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLGVLLFSAFALVAALERPVPVKDMPAGN-----KINGRITNGYPAYEGKVPYIVALRFDNGNGG 62
            :||:.:.:|....|:.          .||     .::.|:..|..|.....|:.|:|::...:..
  Rat     1 MLGITVLAAILACASC----------CGNPAFPPNLSTRVVGGEDAVPNSWPWQVSLQYLKDDTW 55

  Fly    63 GWYCGGSIIGHEWVLTAAHC-----TY----GASYVTI--SYGAVWRQQPQFTHYDTGN---LHN 113
            ...||||:|....|||||||     ||    |...:|:  ..|:|:.:......::..|   |.|
  Rat    56 RHTCGGSLITTSHVLTAAHCINKDFTYRVGLGKYNLTVEDEEGSVYAEVDTIYVHEKWNRLFLWN 120

  Fly   114 DIALIRTPH-VDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDN 177
            |||:|:... |:..:.:....:|.........|..:  ::|||....:..:.:.|......|..:
  Rat   121 DIAIIKLAEPVELSNTIQVACIPEEGSLLPQDYPCY--VTGWGRLWTNGPIAEVLQQGLQPIVSH 183

  Fly   178 SVC--LDYYGSHYITSNHLCYATPENKGSCSGDSGGPL--VLHDGNRQV-GIVSFGSAAGC-LSN 236
            :.|  ||::... :....:|........:|:|||||||  ...||:.|| |||||||::|| :..
  Rat   184 ATCSRLDWWFIK-VRKTMVCAGGDGVISACNGDSGGPLNCQAEDGSWQVHGIVSFGSSSGCNVHK 247

  Fly   237 SPKGLTRVTGYLDWIRD 253
            .|...|||:.|.|||.:
  Rat   248 KPVVFTRVSAYNDWINE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 70/235 (30%)
Tryp_SPc 37..254 CDD:238113 71/238 (30%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 70/235 (30%)
Tryp_SPc 30..265 CDD:238113 71/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.