DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and gammaTry

DIOPT Version :10

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster


Alignment Length:48 Identity:16/48 - (33%)
Similarity:23/48 - (47%) Gaps:13/48 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 YYNKVTK------------ESKWTIPEDLKL-AREQAQLASEKTSLSE 277
            ||.|:.:            ::..||...|:: |||||:|..|.||..|
  Fly    95 YYRKLVQTLFARNTPEPPTKNVHTIDLSLRISAREQAKLLDESTSARE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 3/19 (16%)
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 16/48 (33%)

Return to query results.
Submit another query.