DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG12133

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:296 Identity:67/296 - (22%)
Similarity:106/296 - (35%) Gaps:88/296 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MPAGNKI-----------NGRITNGYPAYEGKVPYIVALRFDNGNGGGWY---------CGGSII 71
            |.||:|:           :..|..|..|...:.|:.|.|.::.      |         |.||:|
  Fly    41 MVAGDKLPDSRVCGQSPPSSYIVGGMEAQSNQFPWTVLLGYEA------YTAKQRPSPMCAGSLI 99

  Fly    72 GHEWVLTAAHCT-----YGA-------------SYVTISYGA-VWR----------QQPQFTHYD 107
            ...:|||||||.     |.|             .|..:..|| :|.          :.|...:|.
  Fly   100 ASRYVLTAAHCLNVNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYT 164

  Fly   108 -TGNLHNDIALIR-TPHVDFWSLVNKVEL-PRYDDRYNNFYGWWALLSGWGSS-----------S 158
             .|..:|||||:| ...|.:...:..:.: |..:...::|..:...::|||.|           .
  Fly   165 RNGRHYNDIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQG 229

  Fly   159 DSSGMTDYLNCVDIQISDNSVCLDYYGSHYITSN-HLCYATPENKGSCSGDSGGPLVLHDGNRQ- 221
            ..|||:.            ..||:.|.:..:..: .:|....:...:..||||.||:...|... 
  Fly   230 TISGMSP------------DECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGAD 282

  Fly   222 -----VGIVSFGSAAGCLSNSPKGLTRVTGYLDWIR 252
                 .||.|:|.........|...|:.:.|.:||:
  Fly   283 QFYYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 61/273 (22%)
Tryp_SPc 37..254 CDD:238113 63/275 (23%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 63/275 (23%)
Tryp_SPc 62..317 CDD:214473 61/272 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.