DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG17572

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:263 Identity:73/263 - (27%)
Similarity:111/263 - (42%) Gaps:49/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 INGRITNGYPAYEGKVPYIVALRFDNGNGG--GWYCGGSIIGHEWVLTAAHCTYG---------- 85
            :.|....|..:|    |::..:.|.:.|.|  .:.|.|::|....:||||||...          
  Fly   129 VQGHFYKGLGSY----PFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSSV 189

  Fly    86 --ASYVTIS--------YGAVWRQQPQFTH------YDTGNLHNDIAL--IRTPHVDFWSLVNKV 132
              ..|.|.|        :.|........:|      |..|..|:||||  ::|| :::......:
  Fly   190 RVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTP-LNYSVATQPI 253

  Fly   133 ELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGS-------HYIT 190
            .|.:  .|.|...|..|.::|||..|.||.....::.:|:.::...:||..|||       :.|.
  Fly   254 CLQK--TRANLVVGKRATIAGWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTGALESPNSIE 316

  Fly   191 SNHLCYATPENKGSCSGDSGGPLVLHDGN--RQVGIVSFGS-AAGCLSNSPKGLTRVTGYLDWIR 252
            ...:| |..|.|..|.|..|.||.:.:..  .|:||:|||| ..|.| ..|...|.|..:.:||.
  Fly   317 GQWMC-AGGEGKDVCQGFGGAPLFIQENGIFSQIGIMSFGSDNCGGL-RIPSVYTSVAHFSEWIH 379

  Fly   253 DHT 255
            |:|
  Fly   380 DNT 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 68/254 (27%)
Tryp_SPc 37..254 CDD:238113 70/256 (27%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 69/251 (27%)
Tryp_SPc 138..378 CDD:214473 67/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.