DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG4650

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:293 Identity:71/293 - (24%)
Similarity:114/293 - (38%) Gaps:82/293 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLGV--LLFSAFALVAALERPVPVKDMPAGNKINGR---ITNGYPAYEGKVPYIVALRFDNGNGG 62
            |:|:  |||..         |||    .:...::||   :|||..|.....|::..|......  
  Fly     5 VIGISALLFLL---------PVP----GSSQYLDGRCGLLTNGKIANNISSPWMAYLHTSELL-- 54

  Fly    63 GWYCGGSIIGHEWVLTAAHCTYGASYVTISYG-------------AVWRQQPQFTH--YDTGNLH 112
             :.|||::|..:.||||||||..:..:....|             :.::....|.|  |:|....
  Fly    55 -YVCGGTVITEKLVLTAAHCTRASEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSA 118

  Fly   113 NDIAL------------IRTPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSG--WGSSSDSSGM 163
            ||||:            ||...:.:|::..|     |.|...       :|||  ||..:|.: .
  Fly   119 NDIAILGLATDIVFSKTIRPICIVWWTIWRK-----YIDNIQ-------VLSGAQWGLPNDRN-E 170

  Fly   164 TDYLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVG-IVSF 227
            :|.....||:....::|....|:..::|..           |:|||...|...|.:..:| |::|
  Fly   171 SDAFRITDIRRQPANMCSTLNGTAILSSQF-----------CAGDSDSKLCNVDFSSPLGAIITF 224

  Fly   228 GS-----AAGCLSNSPKGLTRVTGYLDWIRDHT 255
            .:     ..|..:.:.| ..|.:.|.| :..||
  Fly   225 KNIQRYVLIGIATTNQK-CKRASVYTD-VLSHT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 60/252 (24%)
Tryp_SPc 37..254 CDD:238113 59/251 (24%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 60/252 (24%)
Tryp_SPc 33..258 CDD:304450 60/252 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.