DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and Jon25Bi

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:270 Identity:150/270 - (55%)
Similarity:180/270 - (66%) Gaps:16/270 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLGVLLFSAFALVAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWY 65
            |||..||..:..|:.|...:.|..||:|...||||||.|||||||||.||.|.|.| :|| |||:
  Fly     1 MKVFVVLALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGF-SGN-GGWW 63

  Fly    66 CGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFTH-YDTGNL---H-------NDIALIR 119
            ||||||.|:|||||||||.|||.|||.|||.||...|||| ..:|:.   |       |||||||
  Fly    64 CGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVGSGDFIQNHNWPNQNGNDIALIR 128

  Fly   120 TPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYY 184
            |||||||.:|||||||.::||||.:..:||:..|||.::..| ..|::.|||:||..||.|...|
  Fly   129 TPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGS-QPDWMECVDLQIISNSECSRTY 192

  Fly   185 GSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLTRVTGYLD 249
            |:.  ....||.:|...|.:||||||||||||||.|.||:.|:.|..||.:..|.|.||||..||
  Fly   193 GTQ--PDGILCVSTSGGKSTCSGDSGGPLVLHDGGRLVGVTSWVSGNGCTAGLPSGFTRVTNQLD 255

  Fly   250 WIRDHTGISY 259
            ||||::|::|
  Fly   256 WIRDNSGVAY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 129/225 (57%)
Tryp_SPc 37..254 CDD:238113 131/227 (58%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 129/225 (57%)
Tryp_SPc 37..260 CDD:238113 131/227 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470750
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.