DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and Jon25Biii

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:264 Identity:145/264 - (54%)
Similarity:173/264 - (65%) Gaps:11/264 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLGVLLFSAFALVAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWY 65
            |||...:|..|.|..:|.:..|.|||:|...||.|||||||.|.|||.||.|.|.|    .|||:
  Fly     1 MKVFLAILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGF----SGGWW 61

  Fly    66 CGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFTH-YDTGNL--HN--DIALIRTPHVDF 125
            ||||||.|:|||||.||...|:.|.:.:||.||...|||| ...||.  |:  ||||||.|||||
  Fly    62 CGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTNAQFTHTVGNGNFIKHSNADIALIRIPHVDF 126

  Fly   126 WSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVCLDYYGSHYIT 190
            |.:|||||||.|:|||||:..|||:..|||.:.|.|.:.|:|.|||:||..|..|...|||  :.
  Fly   127 WHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWTYGS--VG 189

  Fly   191 SNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWIRDHT 255
            .|.:|..|.:.|..|.||||||||.|||::.||:.:|.|:.||.|.:|.|..|||.:||||||||
  Fly   190 DNVICTRTVDGKSICGGDSGGPLVTHDGSKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIRDHT 254

  Fly   256 GISY 259
            ||||
  Fly   255 GISY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 120/219 (55%)
Tryp_SPc 37..254 CDD:238113 122/221 (55%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 120/219 (55%)
Tryp_SPc 37..253 CDD:238113 122/221 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470790
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.