DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and ela2l

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_956180.1 Gene:ela2l / 334304 ZFINID:ZDB-GENE-040511-1 Length:267 Species:Danio rerio


Alignment Length:280 Identity:85/280 - (30%)
Similarity:121/280 - (43%) Gaps:56/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLGVLLFSAFALVAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWY-- 65
            ||.||:..|::.           .:|....|..|:..|........|:.::|::.:|:  .||  
Zfish     6 VLAVLVVGAYSC-----------GLPTFPPIVTRVVGGVDVRPNSWPWQISLQYKSGS--NWYHT 57

  Fly    66 CGGSIIGHEWVLTAAHC-----TYGA------------SYVTISYGAV-----WRQQPQFTHYDT 108
            ||||:|..:||||||||     ||..            ..|.|..|.:     |.   .||    
Zfish    58 CGGSLIDKQWVLTAAHCISSSRTYRVFLGKHSLSQEENGSVAIGAGKIIVHEAWN---SFT---- 115

  Fly   109 GNLHNDIALIR-TPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDI 172
              :.||||||: ...|.....:....||  :..|...:.....::|||....:..:.|.|....:
Zfish   116 --IRNDIALIKLETAVTIGDTITPACLP--EAGYVLPHNAPCYVTGWGRLYTNGPLADILQQALL 176

  Fly   173 QISDNSVC--LDYYGSHYITSNHLCYATPENKGSCSGDSGGPL--VLHDGNRQV-GIVSFGSAAG 232
            .:.|::.|  .|::||. :|::.:|.........|.|||||||  ...||..:| |||||||...
Zfish   177 PVVDHATCSKSDWWGSQ-VTTSMVCAGGDGVVAGCDGDSGGPLNCAGSDGAWEVHGIVSFGSGLS 240

  Fly   233 CLSN-SPKGLTRVTGYLDWI 251
            |..| .|...|||:.|.|||
Zfish   241 CNYNKKPTVFTRVSAYSDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 76/245 (31%)
Tryp_SPc 37..254 CDD:238113 77/246 (31%)
ela2lNP_956180.1 Tryp_SPc 28..260 CDD:214473 76/245 (31%)
Tryp_SPc 29..263 CDD:238113 77/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.