DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG8952

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:282 Identity:89/282 - (31%)
Similarity:140/282 - (49%) Gaps:45/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLFSAFALVAALERPV-PVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGW---YCG 67
            |:....|.::.:.:|. |....|.  ||:.||.:|..|..|:.|:.|.|:.|     .|   .||
  Fly     9 LMLVLLAAISVVGQPFDPANSSPI--KIDNRIVSGSDAKLGQFPWQVILKRD-----AWDDLLCG 66

  Fly    68 GSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFTHYDTGN----------LHNDIALIRTPH 122
            ||||...|||||||||.|.|.:.:.:|.|........:..:.|          |:||::||:.|.
  Fly    67 GSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNANALNMTSNNIIIHPDYNDKLNNDVSLIQLPE 131

  Fly   123 -VDFWSLVNKVEL-PRYDDRYNNFYGWWALLSGWGSSSDSSGMTDY---LNCVDIQISDNSVCLD 182
             :.|.:.:..::| .:|.|.. ::.|..|.::|:|.:.|.  ..||   |....::|.||:.|:.
  Fly   132 PLTFSANIQAIQLVGQYGDSI-DYVGSVATIAGFGYTEDE--YLDYSETLLYAQVEIIDNADCVA 193

  Fly   183 YYGSHYITSNHLCYATPENKG-------SCSGDSGGPLVLHDGN----RQVGIVSFGSAAGCLSN 236
            .||.:.:..:.:|     .||       :|:|||||||:|::..    :|:||.||.:...|...
  Fly   194 IYGKYVVVDSTMC-----AKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYR 253

  Fly   237 SPKGLTRVTGYLDWIRDHTGIS 258
            .|.|..||:.:|.:|.|.|||:
  Fly   254 LPSGYARVSSFLGFIADKTGIA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 77/243 (32%)
Tryp_SPc 37..254 CDD:238113 77/245 (31%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 77/243 (32%)
Tryp_SPc 38..271 CDD:238113 77/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471039
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.