DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aii and CG31269

DIOPT Version :9

Sequence 1:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:286 Identity:83/286 - (29%)
Similarity:121/286 - (42%) Gaps:68/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLGVLL-FSAFALVAALERPVPVKDMPAGNKING------RITNGYPAYEGKVPYIVALRFDNGN 60
            ||.:|| .|....:.|:.    :|    ||..:|      ||..|..|.:|..||.::|:   |.
  Fly     5 VLLILLGLSGLVSITAIR----IK----GNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQ---GI 58

  Fly    61 GGGWYCGGSIIGHEWVLTAAHCTYGA--SYVTISYGAVWRQQPQ----------FTHYDTGNLHN 113
            .|...|||:||...:|||||||...|  .::.:..|.....||.          ..:||...:||
  Fly    59 SGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHN 123

  Fly   114 DIALIRTPHVDFW-SLVNKVELPRY-----DDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDI 172
            ||||:.......| .....:.||..     |:         .:|:||||:     :....:.:|:
  Fly   124 DIALLELVEPIAWDERTQPIPLPLVPMQPGDE---------VILTGWGST-----VLWGTSPIDL 174

  Fly   173 QISDNSVCLDYYGSH---YITSN-------HLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSF 227
            |:    :.|.|....   .:.||       |:|..:...:|:|.||||||||  .....||:|::
  Fly   175 QV----LYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLV--SNGYLVGLVNW 233

  Fly   228 GSAAGCLSNSPKGLTRVTGYLDWIRD 253
            |..  |.:..|.....|..|.||||:
  Fly   234 GWP--CATGVPDVHASVYFYRDWIRN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 70/242 (29%)
Tryp_SPc 37..254 CDD:238113 72/245 (29%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/242 (29%)
Tryp_SPc 38..258 CDD:238113 72/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.